Lineage for d3d80a_ (3d80 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903757Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2903902Species Mouse (Mus musculus) [TaxId:10090] [187727] (6 PDB entries)
  8. 2903903Domain d3d80a_: 3d80 A: [173749]
    automated match to d1drfa_
    complexed with gol, ndp, q22

Details for d3d80a_

PDB Entry: 3d80 (more details), 1.4 Å

PDB Description: Structural Analysis of a Holo Enzyme Complex of Mouse Dihydrofolate Reductase with NADPH and a Ternary Complex wtih the Potent and Selective Inhibitor 2,4-Diamino-6-(2'-hydroxydibenz[b,f]azepin-5-yl)methylpteridine
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3d80a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d80a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Mouse (Mus musculus) [TaxId: 10090]}
vrplncivavsqnmgigkngdlpwpplrnefkyfqrmtttssvegkqnlvimgrktwfsi
peknrplkdrinivlsrelkepprgahflakslddalrlieqpelaskvdmvwivggssv
yqeamnqpghlrlfvtrimqefesdtffpeidlgkykllpeypgvlsevqeekgikykfe
vyekkd

SCOPe Domain Coordinates for d3d80a_:

Click to download the PDB-style file with coordinates for d3d80a_.
(The format of our PDB-style files is described here.)

Timeline for d3d80a_: