Lineage for d3d48r2 (3d48 R:101-204)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (2 families) 
Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
Pfam PF00041
Protein automated matches [190888] (2 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries) 
Domain d3d48r2: 3d48 R:101-204 [157290]
Other proteins in same PDB: d3d48p_
automated match to d3mzgb2
complexed with co3
Details for d3d48r2
PDB Entry: 3d48 (more details), 2.5 Å
PDB Description: crystal structure of a prolactin receptor antagonist bound to the extracellular domain of the prolactin receptor
PDB Compounds: (R:) Prolactin receptorSCOPe Domain Sequences for d3d48r2:
Sequence, based on SEQRES records: (download)
>d3d48r2 b.1.2.1 (R:101-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqpdpplelavevkqpedrkpylwikwspptlidlktgwftllyeirlkpekaaeweihf
agqqtefkilslhpgqkylvqvrckpdhgywsawspatfiqips
Sequence, based on observed residues (ATOM records): (download)
>d3d48r2 b.1.2.1 (R:101-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqpdpplelavevkpylwikwspptlidlktgwftllyeirlkpekaaeweihfagqqte
fkilspgqkylvqvrckpdhgywsawspatfiqips
SCOPe Domain Coordinates for d3d48r2:
Click to download the PDB-style file with coordinates for d3d48r2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3d48r2:
- d3d48r2 first appeared in SCOP 1.75
- d3d48r2 appears in SCOPe 2.07
View in 3D
