| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein automated matches [190359] (42 species) not a true protein |
| Species Goat (Capra hircus) [TaxId:9925] [188635] (3 PDB entries) |
| Domain d3d1ab_: 3d1a B: [173614] automated match to d1fsxb_ complexed with hem |
PDB Entry: 3d1a (more details), 2.61 Å
SCOPe Domain Sequences for d3d1ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d1ab_ a.1.1.2 (B:) automated matches {Goat (Capra hircus) [TaxId: 9925]}
mltaeekaavtgfwgkvkvdevgaealgrllvvypwtqrffehfgdlssadavmnnakvk
ahgkkvldsfsngmkhlddlkgtfaqlselhcdklhvdpenfkllgnvlvvvlarhhgse
ftpllqaefqkvvagvanalahryh
Timeline for d3d1ab_: