![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
![]() | Protein Lactate dehydrogenase [51859] (19 species) |
![]() | Species Toxoplasma gondii [TaxId:5811] [102166] (5 PDB entries) |
![]() | Domain d3czma1: 3czm A:16-163 [231915] Other proteins in same PDB: d3czma2, d3czmb2 automated match to d1pzga1 complexed with nad, oxq |
PDB Entry: 3czm (more details), 2.3 Å
SCOPe Domain Sequences for d3czma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3czma1 c.2.1.5 (A:16-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} tvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiadtnv svtsanqyekiagsdvviitagltkvpgksdkewsrndllpfnakiirevaqgvkkycpl afvivvtnpldcmvkcfheasglpknmvcgm
Timeline for d3czma1: