Class a: All alpha proteins [46456] (289 folds) |
Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) |
Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins) |
Protein automated matches [190756] (2 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [188643] (3 PDB entries) |
Domain d3cx8b_: 3cx8 B: [173526] automated match to d1htjf_ complexed with gsp, mg |
PDB Entry: 3cx8 (more details), 2 Å
SCOPe Domain Sequences for d3cx8b_:
Sequence, based on SEQRES records: (download)
>d3cx8b_ a.91.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} liigpeedydpgyfnnesdiifqdleklkshpaylvvflryilsqadpgpllfylcsevy qqtnpkdsrslgkdiwnifleknaplrvkipemlqaeidlrlrnnedprnvlceaqeavm leiqeqindyrskrtlglgslygendllgldgdplrerqmaekqlaalgdilskyeedrs apmdfavntfmshagi
>d3cx8b_ a.91.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} liigpeedydpgnesdiifqdleklkshpaylvvflryilsqadpgpllfylcsevyqqt npkdsrslgkdiwnifleknaplrvkipemlqaeidlrlrnnedprnvlceaqeavmlei qeqindyrskrtlglgslygendllgldgdplrerqmaekqlaalgdilskyeedrsapm dfavntfmshagi
Timeline for d3cx8b_: