Lineage for d3cwvb2 (3cwv B:207-357)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2931129Species Myxococcus xanthus [TaxId:246197] [225453] (1 PDB entry)
  8. 2931131Domain d3cwvb2: 3cwv B:207-357 [208975]
    Other proteins in same PDB: d3cwva1, d3cwvb1
    automated match to d1ei1a1

Details for d3cwvb2

PDB Entry: 3cwv (more details), 1.95 Å

PDB Description: crystal structure of b-subunit of the dna gyrase from myxococcus xanthus
PDB Compounds: (B:) DNA gyrase, B subunit, truncated

SCOPe Domain Sequences for d3cwvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cwvb2 d.14.1.0 (B:207-357) automated matches {Myxococcus xanthus [TaxId: 246197]}
gvaqwahvltearpqlhpepvvfdftwdglrvqcalqwcededstllsfanavrtvrhga
hvkgvtqalrgalaklsgetrgafpwarvaqgltaivavsgprrqmafagptkellaipg
leeairkqlqplfiellrehpvtpallarrt

SCOPe Domain Coordinates for d3cwvb2:

Click to download the PDB-style file with coordinates for d3cwvb2.
(The format of our PDB-style files is described here.)

Timeline for d3cwvb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cwvb1