Lineage for d3crta2 (3crt A:81-214)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) 
Protein Class alpha GST [81349] (8 species) 
Species Schistosoma japonicum [TaxId:6182] [47633] (15 PDB entries)
Uniprot P08515
Domain d3crta2: 3crt A:81-214 [208936]
Other proteins in same PDB: d3crta1
automated match to d1bg5a1
complexed with gsh
Details for d3crta2
PDB Entry: 3crt (more details), 1.9 Å
PDB Description: structural characterization of an engineered allosteric protein
PDB Compounds: (A:) Glutathione S-transferase class-mu 26 kDa isozymeSCOPe Domain Sequences for d3crta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3crta2 a.45.1.1 (A:81-214) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggd
SCOPe Domain Coordinates for d3crta2:
Click to download the PDB-style file with coordinates for d3crta2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3crta2:
- d3crta2 first appeared in SCOPe 2.03
- d3crta2 appears in SCOPe 2.07
View in 3D
