Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.8: Atu1531-like [160742] (3 proteins) Pfam PF10604; Polyketide cyclase/dehydrase and lipid transport |
Protein Uncharacterized protein XoxI [160743] (1 species) |
Species Bacillus cereus [TaxId:1396] [160744] (1 PDB entry) Uniprot Q81AY6 3-140 |
Domain d3cnwa1: 3cnw A:3-140 [156848] Other proteins in same PDB: d3cnwa2, d3cnwb3 |
PDB Entry: 3cnw (more details), 2.48 Å
SCOPe Domain Sequences for d3cnwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cnwa1 d.129.3.8 (A:3-140) Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1396]} mahtttsmeifgspeqvwqliggfnslpdwlpyipssklteggrvrhlanpdgdtiierl evfndkeryytysimnapfpvtnylstiqvkegtesntslvewsgtftpvevsdeeainl fhgiysdglkalqqafld
Timeline for d3cnwa1: