Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) has additional insertions and/or extensions that are not grouped together |
Protein YraM C-terminal domain [159804] (1 species) |
Species Haemophilus influenzae [TaxId:727] [159805] (2 PDB entries) Uniprot P45299 257-573 HI1655 |
Domain d3ckma1: 3ckm A:257-573 [156739] Other proteins in same PDB: d3ckma2 complexed with bme, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3ckm (more details), 1.35 Å
SCOPe Domain Sequences for d3ckma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ckma1 c.93.1.1 (A:257-573) YraM C-terminal domain {Haemophilus influenzae [TaxId: 727]} sqiglllplsgdgqilgttiqsgfndakgnstipvqvfdtsmnsvqdiiaqakqagiktl vgpllkqnldviladpaqiqgmdvlalnatpnsraipqlcyyglspedeaesaankmwnd gvrnplvampqndlgqrvgnafnvrwqqlagtdaniryynlpadvtyfvqennsnttaly avasptelaemkgyltnivpnlaiyassrasasatntntdfiaqmngvqfsdipffkdtn spqyqklakstggeyqlmrlyamgadawllinqfnelrqvpgyrlsgltgilsadtncnv erdmtwyqyqdgaivpv
Timeline for d3ckma1: