Lineage for d3ckma1 (3ckm A:257-573)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
parallel beta-sheet of 6 strands, order 213456Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) 
Similar in architecture to the superfamily II but partly differs in topologyFamily c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
has additional insertions and/or extensions that are not grouped together
Protein YraM C-terminal domain [159804] (1 species) Species Haemophilus influenzae [TaxId:727] [159805] (2 PDB entries)
Uniprot P45299 257-573
HI1655
Domain d3ckma1: 3ckm A:257-573 [156739]
Other proteins in same PDB: d3ckma2
complexed with bme, so4
has additional insertions and/or extensions that are not grouped together
Details for d3ckma1
PDB Entry: 3ckm (more details), 1.35 Å
PDB Description: lpoa (yram) c-domain from haemophilus influenzae, a regulator of pbp1a
PDB Compounds: (A:) yram (hi1655)SCOPe Domain Sequences for d3ckma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ckma1 c.93.1.1 (A:257-573) YraM C-terminal domain {Haemophilus influenzae [TaxId: 727]}
sqiglllplsgdgqilgttiqsgfndakgnstipvqvfdtsmnsvqdiiaqakqagiktl
vgpllkqnldviladpaqiqgmdvlalnatpnsraipqlcyyglspedeaesaankmwnd
gvrnplvampqndlgqrvgnafnvrwqqlagtdaniryynlpadvtyfvqennsnttaly
avasptelaemkgyltnivpnlaiyassrasasatntntdfiaqmngvqfsdipffkdtn
spqyqklakstggeyqlmrlyamgadawllinqfnelrqvpgyrlsgltgilsadtncnv
erdmtwyqyqdgaivpv
SCOPe Domain Coordinates for d3ckma1:
Click to download the PDB-style file with coordinates for d3ckma1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ckma1:
- d3ckma1 first appeared in SCOP 1.75
- d3ckma1 appears in SCOPe 2.07
View in 3D
