Lineage for d3cjia_ (3cji A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assembliesSuperfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) 
Family b.121.4.0: automated matches [191569] (1 protein)
not a true familyProtein automated matches [190988] (51 species)
not a true protein
Species Seneca valley virus [TaxId:390157] [188689] (3 PDB entries) 
Domain d3cjia_: 3cji A: [199192]
automated match to d1tme1_
complexed with ca
Details for d3cjia_
PDB Entry: 3cji (more details), 2.3 Å
PDB Description: Structure of Seneca Valley Virus-001
PDB Compounds: (A:) PolyproteinSCOPe Domain Sequences for d3cjia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cjia_ b.121.4.0 (A:) automated matches {Seneca valley virus [TaxId: 390157]}
stdnaetgvieagntdtdfsgelaapgsnhtnvkflfdrsrllnvikvlekdavfprpfp
tqegaqqddgyfclltprptvasrpatrfglyanpsgsgvlantsldfnfyslacftyfr
sdlevtvvslepdlefavgwfpsgseyqassfvydqlhvpfhftgrtprafaskggkvsf
vlpwnsvssvlpvrwggasklssatrglpahadwgtiyafvprpnekkstavkhvavyir
yknarawcpsmlpfrsyk
SCOPe Domain Coordinates for d3cjia_:
Click to download the PDB-style file with coordinates for d3cjia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3cjia_:
- d3cjia_ first appeared in SCOPe 2.03
- d3cjia_ appears in SCOPe 2.07
View in 3D
