Lineage for d3cina2 (3cin A:210-316)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. Protein Hypothetical protein TM1419 [103105] (1 species)
    myo-inositol 1-phosphate synthase-related protein
  7. Species Thermotoga maritima [TaxId:2336] [103106] (2 PDB entries)
  8. Domain d3cina2: 3cin A:210-316 [173251]
    Other proteins in same PDB: d3cina1, d3cina3
    structural genomics
    complexed with cl, mg, nad

Details for d3cina2

PDB Entry: 3cin (more details), 1.7000000000000002 Å

PDB Description: crystal structure of a myo-inositol-1-phosphate synthase-related protein (tm_1419) from thermotoga maritima msb8 at 1.70 a resolution
PDB Compounds: (A:) Myo-inositol-1-phosphate synthase-related protein

SCOPe Domain Sequences for d3cina2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cina2 d.81.1.3 (A:210-316) Hypothetical protein TM1419 {Thermotoga maritima [TaxId: 2336]}
atgatpftadvlshlaqrnryvkdvaqfniggnmdflaltddgknkskeftkssivkdil
gydaphyikptgyleplgdkkfiaihieyvsfngatdelmingrind

SCOPe Domain Coordinates for d3cina2 are not available.

Timeline for d3cina2:

Domains from same chain:
(mouse over for more information)
d3cina1, d3cina3