| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
| Protein Hypothetical protein TM1419 [102161] (1 species) myo-inositol 1-phosphate synthase-related protein |
| Species Thermotoga maritima [TaxId:2336] [102162] (2 PDB entries) |
| Domain d3cina1: 3cin A:1-209,A:317-381 [173250] Other proteins in same PDB: d3cina2, d3cina3 structural genomics complexed with cl, mg, nad |
PDB Entry: 3cin (more details), 1.7 Å
SCOPe Domain Sequences for d3cina1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cina1 c.2.1.3 (A:1-209,A:317-381) Hypothetical protein TM1419 {Thermotoga maritima [TaxId: 2336]}
mvkvlilgqgyvastfvagleklrkgeiepygvplarelpigfedikivgsydvdrakig
kklsevvkqywndvdsltsdpeirkgvhlgsvrnlpieaegledsmtlkeavdtlvkewt
eldpdvivntctteafvpfgnkedllkaienndkerltatqvyayaaalyankrggaafv
nviptfiandpafvelakennlvvfgddgXspalggllvdlvrlgkialdrkefgtvypv
nafymknpgpaeeknipriiayekmriwaglkpkw
Timeline for d3cina1: