Lineage for d3ciba_ (3cib A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily)
barrel, closed; n=6, S=10, complex topologySuperfamily b.50.1: Acid proteases [50630] (4 families) 
Family b.50.1.2: Pepsin-like [50646] (11 proteins)
duplication: consists of two similar barrel domains
N-terminal: barrel, partly opened; n*=6, S*=10
Protein beta-secretase (memapsin) [50671] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50672] (329 PDB entries)
Uniprot P56817 58-446 ! Uniprot P56817 60-447
Domain d3ciba_: 3cib A: [156664]
automated match to d1fkna_
complexed with 314, tar
Details for d3ciba_
PDB Entry: 3cib (more details), 1.72 Å
PDB Description: structure of bace bound to sch727596
PDB Compounds: (A:) Beta-secretase 1SCOPe Domain Sequences for d3ciba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ciba_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
sachvhdefrtaavegpfvtldmedcgyni
SCOPe Domain Coordinates for d3ciba_:
Click to download the PDB-style file with coordinates for d3ciba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ciba_:
- d3ciba_ first appeared in SCOP 1.75, called d3ciba1
- d3ciba_ appears in SCOPe 2.07
View in 3D
