Lineage for d3ci4a_ (3ci4 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1730363Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 1730382Family a.25.2.0: automated matches [191442] (1 protein)
    not a true family
  6. 1730383Protein automated matches [190652] (6 species)
    not a true protein
  7. 1730402Species Lactobacillus reuteri [TaxId:1598] [188444] (9 PDB entries)
  8. 1730409Domain d3ci4a_: 3ci4 A: [173247]
    automated match to d1rtyb_
    complexed with atp, cby, k, mg

Details for d3ci4a_

PDB Entry: 3ci4 (more details), 2 Å

PDB Description: Structure of the PduO-type ATP:co(I)rrinoid adenosyltransferase from Lactobacillus reuteri complexed with four-coordinate cob(II)inamide and ATP
PDB Compounds: (A:) Cobalamin adenosyltransferase PduO-like protein

SCOPe Domain Sequences for d3ci4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ci4a_ a.25.2.0 (A:) automated matches {Lactobacillus reuteri [TaxId: 1598]}
vkiytkngdkgqtriigkqilykndprvaaygevdelnswvgytkslinshtqvlsnele
eiqqllfdcghdlatpadderhsfkfkqeqptvwleekidnytqvvpavkkfilpggtql
asalhvartitrraerqivqlmreeqinqdvlifinrlsdyffaaaryanyleqqpdmly
rnskdvf

SCOPe Domain Coordinates for d3ci4a_:

Click to download the PDB-style file with coordinates for d3ci4a_.
(The format of our PDB-style files is described here.)

Timeline for d3ci4a_: