Lineage for d3cdkc_ (3cdk C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922594Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2922595Protein automated matches [191112] (17 species)
    not a true protein
  7. 2922665Species Bacillus subtilis [TaxId:1423] [225422] (1 PDB entry)
  8. 2922667Domain d3cdkc_: 3cdk C: [208853]
    automated match to d1k6da_

Details for d3cdkc_

PDB Entry: 3cdk (more details), 2.59 Å

PDB Description: Crystal structure of the co-expressed succinyl-CoA transferase A and B complex from Bacillus subtilis
PDB Compounds: (C:) Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A

SCOPe Domain Sequences for d3cdkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cdkc_ c.124.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]}
mgkvlssskeaaklihdgdtliaggfglcgipeqlilsirdqgvkdltvvsnncgvddwg
lglllankqikkmiasyvgenkiferqflsgelevelvpqgtlaeriraggagipgfyta
tgvgtsiaegkehktfggrtyvlergitgdvaivkawkadtmgnlifrktarnfnpiaam
agkitiaeaeeiveageldpdhihtpgiyvqhvvlgasqekriekrtvq

SCOPe Domain Coordinates for d3cdkc_:

Click to download the PDB-style file with coordinates for d3cdkc_.
(The format of our PDB-style files is described here.)

Timeline for d3cdkc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3cdka_