Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) |
Family c.124.1.0: automated matches [191609] (1 protein) not a true family |
Protein automated matches [191112] (17 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [225422] (1 PDB entry) |
Domain d3cdkc_: 3cdk C: [208853] automated match to d1k6da_ |
PDB Entry: 3cdk (more details), 2.59 Å
SCOPe Domain Sequences for d3cdkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cdkc_ c.124.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]} mgkvlssskeaaklihdgdtliaggfglcgipeqlilsirdqgvkdltvvsnncgvddwg lglllankqikkmiasyvgenkiferqflsgelevelvpqgtlaeriraggagipgfyta tgvgtsiaegkehktfggrtyvlergitgdvaivkawkadtmgnlifrktarnfnpiaam agkitiaeaeeiveageldpdhihtpgiyvqhvvlgasqekriekrtvq
Timeline for d3cdkc_: