Lineage for d3cbxa_ (3cbx A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.36: PDZ domain-like [50155] (1 superfamily)
contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helixSuperfamily b.36.1: PDZ domain-like [50156] (7 families) 
peptide-binding domainFamily b.36.1.1: PDZ domain [50157] (47 proteins)
Pfam PF00595
Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (3 species) Species Human (Homo sapiens) [TaxId:9606] [188234] (5 PDB entries) 
Domain d3cbxa_: 3cbx A: [173122]
automated match to d1l6oa_
complexed with cl, mpd
Details for d3cbxa_
PDB Entry: 3cbx (more details), 1.7 Å
PDB Description: the dvl2 pdz domain in complex with the c1 inhibitory peptide
PDB Compounds: (A:) Dishevelled-2SCOPe Domain Sequences for d3cbxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cbxa_ b.36.1.1 (A:) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]}
gshmniitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllq
vndmnfenmsnddavrvlrdivhkpgpivltvaksgggwkwygwf
SCOPe Domain Coordinates for d3cbxa_:
Click to download the PDB-style file with coordinates for d3cbxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3cbxa_:
- d3cbxa_ first appeared in SCOPe 2.01
- d3cbxa_ appears in SCOPe 2.04
- d3cbxa_ is called d3cbxa1 in SCOPe 2.06
- d3cbxa_ appears in the current release, SCOPe 2.08, called d3cbxa1
View in 3D
