Lineage for d3cb7a_ (3cb7 A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) Fold d.2: Lysozyme-like [53954] (1 superfamily)
common alpha+beta motif for the active site regionSuperfamily d.2.1: Lysozyme-like [53955] (12 families) 
Family d.2.1.0: automated matches [191411] (1 protein)
not a true familyProtein automated matches [190563] (12 species)
not a true protein
Species House fly (Musca domestica) [TaxId:7370] [187696] (3 PDB entries) 
Domain d3cb7a_: 3cb7 A: [173114]
automated match to d1gd6a_
complexed with acy, gol, ipa
Details for d3cb7a_
PDB Entry: 3cb7 (more details), 1.9 Å
PDB Description: The crystallographic structure of the digestive lysozyme 2 from Musca domestica at 1.9 Ang.
PDB Compounds: (A:) Lys-rich lysozyme 2SCOPe Domain Sequences for d3cb7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cb7a_ d.2.1.0 (A:) automated matches {House fly (Musca domestica) [TaxId: 7370]}
eaeaktftrcslaremyklgvpknqlarwtciaehessyntkavgslnsngsrdygifqi
nnyywcsppsgafsydeckikcedflvdsiepavkcaqlvlkqqgwtawstwkycdgtlp
siddcf
SCOPe Domain Coordinates for d3cb7a_:
Click to download the PDB-style file with coordinates for d3cb7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3cb7a_:
- d3cb7a_ first appeared in SCOPe 2.01
- d3cb7a_ appears in SCOPe 2.04
- d3cb7a_ is called d3cb7a1 in SCOPe 2.06
- d3cb7a_ appears in the current release, SCOPe 2.08, called d3cb7a1
View in 3D
