Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.0: automated matches [191411] (1 protein) not a true family |
Protein automated matches [190563] (12 species) not a true protein |
Species House fly (Musca domestica) [TaxId:7370] [187696] (3 PDB entries) |
Domain d3cb7a_: 3cb7 A: [173114] automated match to d1gd6a_ complexed with acy, gol, ipa |
PDB Entry: 3cb7 (more details), 1.9 Å
SCOPe Domain Sequences for d3cb7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cb7a_ d.2.1.0 (A:) automated matches {House fly (Musca domestica) [TaxId: 7370]} eaeaktftrcslaremyklgvpknqlarwtciaehessyntkavgslnsngsrdygifqi nnyywcsppsgafsydeckikcedflvdsiepavkcaqlvlkqqgwtawstwkycdgtlp siddcf
Timeline for d3cb7a_: