Lineage for d3cama_ (3cam A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) 
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
barrel, closed; n=5, S=8
Protein automated matches [190915] (6 species)
not a true protein
Species Neisseria meningitidis [TaxId:122586] [188390] (1 PDB entry) 
Domain d3cama_: 3cam A: [173100]
automated match to d1mjca_
Details for d3cama_
PDB Entry: 3cam (more details), 2.6 Å
PDB Description: crystal structure of the cold shock domain protein from neisseria meningitidis
PDB Compounds: (A:) Cold-shock domain family proteinSCOPe Domain Sequences for d3cama_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cama_ b.40.4.5 (A:) automated matches {Neisseria meningitidis [TaxId: 122586]}
matgivkwfndakgfgfitpdeggedlfahfsainmegfktlkegqrvsfdvttgpkgkq
aaniqaa
SCOPe Domain Coordinates for d3cama_:
Click to download the PDB-style file with coordinates for d3cama_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3cama_:
- d3cama_ first appeared in SCOPe 2.01
- d3cama_ appears in SCOPe 2.04
- d3cama_ appears in SCOPe 2.06
- d3cama_ appears in the current release, SCOPe 2.08
View in 3D
