Lineage for d3caka_ (3cak A:)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) 
the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
has transition metal ions bound inside the barrelFamily c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
automatically mapped to Pfam PF02126Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (4 species) Species Pseudomonas diminuta [TaxId:293] [51566] (19 PDB entries)
Uniprot P0A434 30-365
Domain d3caka_: 3cak A: [173098]
automated match to d1hzya_
complexed with btb, co, dpf, efs
Details for d3caka_
PDB Entry: 3cak (more details), 1.83 Å
PDB Description: x-ray structure of wt pte with ethyl phosphate
PDB Compounds: (A:) Parathion hydrolaseSCOPe Domain Sequences for d3caka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3caka_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]}
drintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraag
vrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflrei
qygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqaa
ifeseglspsrvcighsddtddlsyltalaargyligldhiphsaiglednasasallgi
rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvip
flrekgvpqetlagitvtnparflsptlra
SCOPe Domain Coordinates for d3caka_:
Click to download the PDB-style file with coordinates for d3caka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3caka_:
- d3caka_ first appeared in SCOPe 2.01
- d3caka_ appears in SCOPe 2.02
- d3caka_ appears in SCOPe 2.04
- d3caka_ appears in the current release, SCOPe 2.08
View in 3D
