| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) ![]() |
| Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins) |
| Protein Thiamine monophosphate kinase (ThiL) N-terminal domain [118030] (1 species) |
| Species Aquifex aeolicus [TaxId:63363] [118031] (5 PDB entries) Uniprot O67883 |
| Domain d3c9ua1: 3c9u A:1-137 [156144] Other proteins in same PDB: d3c9ua2, d3c9ua3, d3c9ub2, d3c9ub3 automated match to d3c9ua1 complexed with adp, mg, tpp |
PDB Entry: 3c9u (more details), 1.48 Å
SCOPe Domain Sequences for d3c9ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c9ua1 d.79.4.1 (A:1-137) Thiamine monophosphate kinase (ThiL) N-terminal domain {Aquifex aeolicus [TaxId: 63363]}
mrlkelgefglidlikktleskvigddtapveycskklllttdvlnegvhflrsyipeav
gwkaisvnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggni
sksekigisvflvgete
Timeline for d3c9ua1: