Lineage for d3c9fa1 (3c9f A:338-560)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578514Fold d.114: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55815] (1 superfamily)
    core: alpha-beta(2)-alpha-beta(2)-alpha-beta; 3 layers; mixed sheet: order 31425
  4. 2578515Superfamily d.114.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55816] (2 families) (S)
  5. 2578516Family d.114.1.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55817] (1 protein)
  6. 2578517Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55818] (3 species)
  7. 2578536Species Yeast (Candida albicans) [TaxId:5476] [160693] (1 PDB entry)
    Uniprot Q5A5Q7 338-561
  8. 2578537Domain d3c9fa1: 3c9f A:338-560 [156125]
    Other proteins in same PDB: d3c9fa2, d3c9fa3, d3c9fb2
    complexed with fmt, na, zn

Details for d3c9fa1

PDB Entry: 3c9f (more details), 1.9 Å

PDB Description: crystal structure of 5'-nucleotidase from candida albicans sc5314
PDB Compounds: (A:) 5'-nucleotidase

SCOPe Domain Sequences for d3c9fa1:

Sequence, based on SEQRES records: (download)

>d3c9fa1 d.114.1.1 (A:338-560) 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain {Yeast (Candida albicans) [TaxId: 5476]}
dtligyvktnyyvdyvpidhpksifnllalkilktlpkskheeritiintgsirydlykg
pytidskfivspfeniwvnitvpksvatkvaaklndadyisasrlkpphqydlqvqdlst
sphqahfemqeklpkgyvthddfgadgddtlhravvnfpvpnviqsveindevdspvnlv
fysfitpniiwalkelnfsteqvptpysdiylgtllnefvann

Sequence, based on observed residues (ATOM records): (download)

>d3c9fa1 d.114.1.1 (A:338-560) 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain {Yeast (Candida albicans) [TaxId: 5476]}
dtligyvktnyyvdyvpidhpksifnllalkilktlpkskheeritiintgsirydlykg
pytidskfivspfeniwvnitvpksvatkvaaklndyisasrlkpphqydlqvqqeklpk
gyvthddfgadgddtlhravvnfpvpnviqsveindevdspvnlvfysfitpniiwalke
lnfsteqvptpysdiylgtllnefvann

SCOPe Domain Coordinates for d3c9fa1:

Click to download the PDB-style file with coordinates for d3c9fa1.
(The format of our PDB-style files is described here.)

Timeline for d3c9fa1: