Lineage for d3c99a_ (3c99 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. Family b.69.4.1: WD40-repeat [50979] (17 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. Protein Chromatin Assembly Factor 1 (CAF1) p55 subunit [310796] (1 species)
    Includes Pfam PF12265
  7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [311056] (2 PDB entries)
  8. Domain d3c99a_: 3c99 A: [305158]
    automated match to d3c9ca_
    complexed with cd

    has additional insertions and/or extensions that are not grouped together

Details for d3c99a_

PDB Entry: 3c99 (more details), 2.9 Å

PDB Description: Structural Basis of Histone H4 Recognition by p55
PDB Compounds: (A:) Chromatin assembly factor 1 p55 subunit

SCOPe Domain Sequences for d3c99a_:

Sequence, based on SEQRES records: (download)

>d3c99a_ b.69.4.1 (A:) Chromatin Assembly Factor 1 (CAF1) p55 subunit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sfddaveervineeykiwkkntpflydlvmthalewpsltaqwlpdvtkqdgkdysvhrl
ilgthtsdeqnhlliasvqlpsedaqfdgshydnekgefggfgsvcgkieieikinhege
vnrarympqnacviatktpssdvlvfdytkhpskpepsgecqpdlrlrghqkegyglswn
pnlngyllsasddhticlwdinatpkehrvidakniftghtavvedvawhllheslfgsv
addqklmiwdtrnnntskpshtvdahtaevnclsfnpysefilatgsadktvalwdlrnl
klklhsfeshkdeifqvqwsphnetilassgtdrrlhvwdlskigeeqstedaedgppel
lfihgghtakisdfswnpnepwiicsvsednimqvwqmaenvynd

Sequence, based on observed residues (ATOM records): (download)

>d3c99a_ b.69.4.1 (A:) Chromatin Assembly Factor 1 (CAF1) p55 subunit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sfddaveervineeykiwkkntpflydlvmthalewpsltaqwlpdvtkqdgkdysvhrl
ilgthtsdeqnhlliasvqlpsedfgsvcgkieieikinhegevnrarympqnacviatk
tpssdvlvfdytkhpcqpdlrlrghqkegyglswnpnlngyllsasddhticlwdinatp
kehrvidakniftghtavvedvawhllheslfgsvaddqklmiwdtrnnntskpshtvda
htaevnclsfnpysefilatgsadktvalwdlrnlklklhsfeshkdeifqvqwsphnet
ilassgtdrrlhvwdlskigeeqstedaedgppellfihgghtakisdfswnpnepwiic
svsednimqvwqmaenvynd

SCOPe Domain Coordinates for d3c99a_ are not available.

Timeline for d3c99a_: