Lineage for d3c7kb_ (3c7k B:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
multihelical; consists of two all-alpha subdomains
contains a 4-helical bundle with left-handed twist and up-and-down topologySuperfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) 
Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins) 
Protein Regulator of G-protein signaling 16, RGS16 [158689] (2 species) Species Mouse (Mus musculus) [TaxId:10090] [188430] (2 PDB entries) 
Domain d3c7kb_: 3c7k B: [173069]
automated match to d2ik8b1
complexed with alf, gdp, mg
Details for d3c7kb_
PDB Entry: 3c7k (more details), 2.9 Å
PDB Description: molecular architecture of galphao and the structural basis for rgs16- mediated deactivation
PDB Compounds: (B:) Regulator of G-protein signaling 16SCOPe Domain Sequences for d3c7kb_:
Sequence, based on SEQRES records: (download)
>d3c7kb_ a.91.1.1 (B:) Regulator of G-protein signaling 16, RGS16 {Mouse (Mus musculus) [TaxId: 10090]}
vlgwresfdlllnskngvaafhaflktefseenlefwlaceefkkirsatklasrahhif
deyirseapkevnidhetreltktnlqaattscfdvaqgktrtlmekdsyprflkspayr
Sequence, based on observed residues (ATOM records): (download)
>d3c7kb_ a.91.1.1 (B:) Regulator of G-protein signaling 16, RGS16 {Mouse (Mus musculus) [TaxId: 10090]}
vlgwrsfdlllnskngvaafhaflktefseenlefwlaceefkkirsatklasrahhifd
eyirseapkevnidhetreltktnlqaattscfdvaqgktrtlmekdsyprflkspayr
SCOPe Domain Coordinates for d3c7kb_:
Click to download the PDB-style file with coordinates for d3c7kb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3c7kb_:
- d3c7kb_ first appeared in SCOPe 2.01
- d3c7kb_ appears in SCOPe 2.05
- d3c7kb_ appears in SCOPe 2.07
- d3c7kb_ appears in the current release, SCOPe 2.08
View in 3D
