Lineage for d3c5aa_ (3c5a A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2619748Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2619749Protein automated matches [190857] (70 species)
    not a true protein
  7. 2620022Species Escherichia coli [TaxId:562] [225496] (22 PDB entries)
  8. 2620023Domain d3c5aa_: 3c5a A: [208788]
    automated match to d3g32a_
    complexed with cit; mutant

Details for d3c5aa_

PDB Entry: 3c5a (more details), 1.23 Å

PDB Description: Crystal structure of the C-terminal deleted mutant of the class A carbapenemase KPC-2 at 1.23 angstrom
PDB Compounds: (A:) Class A carbapenemase KPC-2

SCOPe Domain Sequences for d3c5aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c5aa_ e.3.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
tnlvaepfakleqdfggsigvyamdtgsgatvsyraeerfplcssfkgflaaavlarsqq
qaglldtpirygknalvpwspisekylttgmtvaelsaaavqysdnaaanlllkelggpa
gltafmrsigdttfrldrwelelnsaipgdardtsspravteslqkltlgsalaapqrqq
fvdwlkgnttgnhriraavpadwavgdktgtcgvygtandyavvwptgrapivlavytra
pnkddkhseaviaaaarlaleglg

SCOPe Domain Coordinates for d3c5aa_:

Click to download the PDB-style file with coordinates for d3c5aa_.
(The format of our PDB-style files is described here.)

Timeline for d3c5aa_: