Lineage for d3c4ia_ (3c4i A:)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
core: 4 helices; bundle, partly opened, capped with a beta-sheetSuperfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) 
dimer of identical subunitsFamily a.55.1.0: automated matches [191573] (1 protein)
not a true familyProtein automated matches [191007] (5 species)
not a true protein
Species Mycobacterium tuberculosis [TaxId:1773] [188755] (3 PDB entries) 
Domain d3c4ia_: 3c4i A: [173040]
automated match to d1huea_
complexed with fmt
Details for d3c4ia_
PDB Entry: 3c4i (more details), 2.04 Å
PDB Description: Crystal structure Analysis of N terminal region containing the dimerization domain and DNA binding domain of HU protein(Histone like protein-DNA binding) from Mycobacterium tuberculosis [H37Rv]
PDB Compounds: (A:) DNA-binding protein HU homologSCOPe Domain Sequences for d3c4ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c4ia_ a.55.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mnkaelidvltqklgsdrrqataavenvvdtivravhkgdsvtitgfgvfeqrrraarva
rnprtgetvkvkptsvpafrpgaqfkavvsgaqrlpaeg
SCOPe Domain Coordinates for d3c4ia_:
Click to download the PDB-style file with coordinates for d3c4ia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3c4ia_:
- d3c4ia_ first appeared in SCOPe 2.01
- d3c4ia_ appears in SCOPe 2.03
- d3c4ia_ does not appear in SCOPe 2.05
View in 3D
