Lineage for d3c49a1 (3c49 A:178-321)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712204Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2712205Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2712230Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 2712231Protein automated matches [226964] (2 species)
    not a true protein
  7. 2712235Species Human (Homo sapiens) [TaxId:9606] [225405] (62 PDB entries)
  8. 2712283Domain d3c49a1: 3c49 A:178-321 [208776]
    Other proteins in same PDB: d3c49a2, d3c49a3
    automated match to d1gs0a1
    complexed with ku8

Details for d3c49a1

PDB Entry: 3c49 (more details), 2.8 Å

PDB Description: Human poly(ADP-ribose) polymerase 3, catalytic fragment in complex with an inhibitor KU0058948
PDB Compounds: (A:) Poly(ADP-ribose) polymerase 3

SCOPe Domain Sequences for d3c49a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c49a1 a.41.1.0 (A:178-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealeale
ealkgptdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladielaqa
lqavseqektveevphpldrdyql

SCOPe Domain Coordinates for d3c49a1:

Click to download the PDB-style file with coordinates for d3c49a1.
(The format of our PDB-style files is described here.)

Timeline for d3c49a1: