Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (59 species) not a true protein |
Species Methanoculleus marisnigri [TaxId:368407] [188339] (1 PDB entry) |
Domain d3c3ma_: 3c3m A: [173020] automated match to d1nxoa_ complexed with gol |
PDB Entry: 3c3m (more details), 1.7 Å
SCOPe Domain Sequences for d3c3ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c3ma_ c.23.1.0 (A:) automated matches {Methanoculleus marisnigri [TaxId: 368407]} slytilvvddspmivdvfvtmlerggyrpitafsgeeclealnatppdlvlldimmepmd gwetleriktdpatrdipvlmltakpltpeeaneygsyiedyilkptthhqlyeaiehvl arr
Timeline for d3c3ma_: