Lineage for d3c3ma_ (3c3m A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1838070Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1838071Protein automated matches [190131] (59 species)
    not a true protein
  7. 1838205Species Methanoculleus marisnigri [TaxId:368407] [188339] (1 PDB entry)
  8. 1838206Domain d3c3ma_: 3c3m A: [173020]
    automated match to d1nxoa_
    complexed with gol

Details for d3c3ma_

PDB Entry: 3c3m (more details), 1.7 Å

PDB Description: crystal structure of the n-terminal domain of response regulator receiver protein from methanoculleus marisnigri jr1
PDB Compounds: (A:) Response regulator receiver protein

SCOPe Domain Sequences for d3c3ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c3ma_ c.23.1.0 (A:) automated matches {Methanoculleus marisnigri [TaxId: 368407]}
slytilvvddspmivdvfvtmlerggyrpitafsgeeclealnatppdlvlldimmepmd
gwetleriktdpatrdipvlmltakpltpeeaneygsyiedyilkptthhqlyeaiehvl
arr

SCOPe Domain Coordinates for d3c3ma_:

Click to download the PDB-style file with coordinates for d3c3ma_.
(The format of our PDB-style files is described here.)

Timeline for d3c3ma_: