Lineage for d3c0da1 (3c0d A:4-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782547Family b.33.1.3: NirD-like [158991] (1 protein)
    retains the common fold but lacks the Fe-S cluster
    automatically mapped to Pfam PF13806
  6. 2782548Protein NADH-nitrite reductase small subunit NirD [158992] (3 species)
  7. 2782553Species Vibrio parahaemolyticus [TaxId:670] [158995] (1 PDB entry)
    Uniprot Q87HB1 4-111
  8. 2782554Domain d3c0da1: 3c0d A:4-111 [155819]
    Other proteins in same PDB: d3c0da2

Details for d3c0da1

PDB Entry: 3c0d (more details), 2.4 Å

PDB Description: crystal structure of the putative nitrite reductase nadph (small subunit) oxidoreductase protein q87hb1. northeast structural genomics consortium target vpr162
PDB Compounds: (A:) Putative nitrite reductase NADPH (Small subunit) oxidoreductase protein

SCOPe Domain Sequences for d3c0da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c0da1 b.33.1.3 (A:4-111) NADH-nitrite reductase small subunit NirD {Vibrio parahaemolyticus [TaxId: 670]}
ltkvklcqlddlmpfigatvliegervalfyipdsgvyavqdwdpigkayvmsrgivgdi
ngemcvasplykqhfslksgqcledeahclktwrvtvddnqvcylake

SCOPe Domain Coordinates for d3c0da1:

Click to download the PDB-style file with coordinates for d3c0da1.
(The format of our PDB-style files is described here.)

Timeline for d3c0da1: