Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
Protein Putative transcriptional regulator SCO4850 [158258] (1 species) |
Species Streptomyces coelicolor [TaxId:1902] [158259] (1 PDB entry) Uniprot Q9KZ96 15-89 |
Domain d3c07a1: 3c07 A:15-89 [155807] Other proteins in same PDB: d3c07a2, d3c07b2 complexed with so4 |
PDB Entry: 3c07 (more details), 2.7 Å
SCOPe Domain Sequences for d3c07a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c07a1 a.4.1.9 (A:15-89) Putative transcriptional regulator SCO4850 {Streptomyces coelicolor [TaxId: 1902]} skseqtraliletamrlfqergydrttmraiaqeagvsvgnayyyfagkehliqgfydri aaehraavrevlare
Timeline for d3c07a1: