Lineage for d3bz6a2 (3bz6 A:97-180)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307864Family a.4.5.75: PSPTO2686-like [158311] (1 protein)
    Pfam PF04337; DUF480; duplication: two "winged helix" domains are tightly packed "back-to-back" about pseudo twofold axis
  6. 2307865Protein Hypothetical protein PSPTO2686 [158312] (1 species)
  7. 2307866Species Pseudomonas syringae pv. tomato [TaxId:323] [158313] (2 PDB entries)
    Uniprot Q882E2 13-96! Uniprot Q882E2 97-180
  8. 2307868Domain d3bz6a2: 3bz6 A:97-180 [155740]

Details for d3bz6a2

PDB Entry: 3bz6 (more details), 2.21 Å

PDB Description: Crystal structure of a conserved protein of unknown function from Pseudomonas syringae pv. tomato str. DC3000
PDB Compounds: (A:) UPF0502 protein PSPTO_2686

SCOPe Domain Sequences for d3bz6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz6a2 a.4.5.75 (A:97-180) Hypothetical protein PSPTO2686 {Pseudomonas syringae pv. tomato [TaxId: 323]}
vdkglelvpaqviltgllllrgpqtvselltrsnrmhdfedseqvvhqlerliarglatl
vprqsgqredrymhligdpedlqd

SCOPe Domain Coordinates for d3bz6a2:

Click to download the PDB-style file with coordinates for d3bz6a2.
(The format of our PDB-style files is described here.)

Timeline for d3bz6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bz6a1