Lineage for d3bz6a2 (3bz6 A:97-180)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) 
contains a small beta-sheet (wing)
Family a.4.5.75: PSPTO2686-like [158311] (1 protein)
Pfam PF04337; DUF480; duplication: two "winged helix" domains are tightly packed "back-to-back" about pseudo twofold axisProtein Hypothetical protein PSPTO2686 [158312] (1 species) Species Pseudomonas syringae pv. tomato [TaxId:323] [158313] (2 PDB entries)
Uniprot Q882E2 13-96! Uniprot Q882E2 97-180
Domain d3bz6a2: 3bz6 A:97-180 [155740]
Details for d3bz6a2
PDB Entry: 3bz6 (more details), 2.21 Å
PDB Description: Crystal structure of a conserved protein of unknown function from Pseudomonas syringae pv. tomato str. DC3000
PDB Compounds: (A:) UPF0502 protein PSPTO_2686SCOPe Domain Sequences for d3bz6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bz6a2 a.4.5.75 (A:97-180) Hypothetical protein PSPTO2686 {Pseudomonas syringae pv. tomato [TaxId: 323]}
vdkglelvpaqviltgllllrgpqtvselltrsnrmhdfedseqvvhqlerliarglatl
vprqsgqredrymhligdpedlqd
SCOPe Domain Coordinates for d3bz6a2:
Click to download the PDB-style file with coordinates for d3bz6a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3bz6a2:
- d3bz6a2 first appeared in SCOP 1.75
- d3bz6a2 appears in SCOPe 2.05
- d3bz6a2 appears in SCOPe 2.07
- d3bz6a2 appears in the current release, SCOPe 2.08
View in 3D
