Lineage for d3bz2h_ (3bz2 H:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958475Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (1 family) (S)
    automatically mapped to Pfam PF00737
  5. 1958476Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 1958483Protein automated matches [191001] (2 species)
    not a true protein
  7. 1958484Species Thermosynechococcus elongatus [TaxId:32046] [188746] (2 PDB entries)
  8. 1958485Domain d3bz2h_: 3bz2 H: [172957]
    Other proteins in same PDB: d3bz2a_, d3bz2b_, d3bz2c_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2i_, d3bz2j_, d3bz2k_, d3bz2l_, d3bz2m_, d3bz2o_, d3bz2t_, d3bz2u_, d3bz2v_, d3bz2z_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2h_

PDB Entry: 3bz2 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer
PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d3bz2h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz2h_ f.23.33.1 (H:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkalg

SCOPe Domain Coordinates for d3bz2h_:

Click to download the PDB-style file with coordinates for d3bz2h_.
(The format of our PDB-style files is described here.)

Timeline for d3bz2h_: