Lineage for d3byyb2 (3byy B:117-235)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179689Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2179690Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2179755Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)
  7. 2179756Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries)
    Uniprot P23313
  8. 2179766Domain d3byyb2: 3byy B:117-235 [231873]
    Other proteins in same PDB: d3byya_, d3byyb1
    automated match to d1se4a2
    complexed with so4

Details for d3byyb2

PDB Entry: 3byy (more details), 2.2 Å

PDB Description: Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
PDB Compounds: (B:) Enterotoxin type C-3

SCOPe Domain Sequences for d3byyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3byyb2 d.15.6.1 (B:117-235) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
egnhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefns
spyetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk

SCOPe Domain Coordinates for d3byyb2:

Click to download the PDB-style file with coordinates for d3byyb2.
(The format of our PDB-style files is described here.)

Timeline for d3byyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3byyb1
View in 3D
Domains from other chains:
(mouse over for more information)
d3byya_