Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.9: Cation efflux protein cytoplasmic domain-like [160240] (2 families) |
Family d.52.9.1: Cation efflux protein cytoplasmic domain-like [160241] (2 proteins) C=terminal part of Pfam PF01545 |
Protein Putative Zinc transporter CzrB [160242] (1 species) |
Species Thermus thermophilus [TaxId:274] [160243] (2 PDB entries) Uniprot Q8VLX7 203-284 |
Domain d3bypa1: 3byp A:6-87 [155726] complexed with so4 |
PDB Entry: 3byp (more details), 1.7 Å
SCOPe Domain Sequences for d3bypa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bypa1 d.52.9.1 (A:6-87) Putative Zinc transporter CzrB {Thermus thermophilus [TaxId: 274]} glppeeveriraflqerirgralevhdlktrragprsflefhlvvrgdtpveeahrlcde leralaqafpglqatihvepeg
Timeline for d3bypa1: