Lineage for d3bypa1 (3byp A:6-87)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
Superfamily d.52.9: Cation efflux protein cytoplasmic domain-like [160240] (2 families) 
Family d.52.9.1: Cation efflux protein cytoplasmic domain-like [160241] (2 proteins)
C=terminal part of Pfam PF01545Protein Putative Zinc transporter CzrB [160242] (1 species) Species Thermus thermophilus [TaxId:274] [160243] (2 PDB entries)
Uniprot Q8VLX7 203-284
Domain d3bypa1: 3byp A:6-87 [155726]
complexed with so4
Details for d3bypa1
PDB Entry: 3byp (more details), 1.7 Å
PDB Description: Mode of Action of a Putative Zinc Transporter CzrB
PDB Compounds: (A:) CzrB proteinSCOPe Domain Sequences for d3bypa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bypa1 d.52.9.1 (A:6-87) Putative Zinc transporter CzrB {Thermus thermophilus [TaxId: 274]}
glppeeveriraflqerirgralevhdlktrragprsflefhlvvrgdtpveeahrlcde
leralaqafpglqatihvepeg
SCOPe Domain Coordinates for d3bypa1:
Click to download the PDB-style file with coordinates for d3bypa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3bypa1:
- d3bypa1 first appeared in SCOP 1.75
- d3bypa1 appears in SCOPe 2.06
- d3bypa1 appears in the current release, SCOPe 2.08
View in 3D
