Lineage for d3buef_ (3bue F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656918Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1656978Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) (S)
    forms trimers with three closely packed beta-sheets
  5. 1657020Family d.74.2.0: automated matches [194896] (1 protein)
    not a true family
  6. 1657021Protein automated matches [194897] (1 species)
    not a true protein
  7. 1657022Species Mycobacterium tuberculosis [TaxId:83332] [194898] (3 PDB entries)
  8. 1657040Domain d3buef_: 3bue F: [194899]
    automated match to d1b4ba_

Details for d3buef_

PDB Entry: 3bue (more details), 2.15 Å

PDB Description: Crystal structure of the C-terminal domain hexamer of ArgR from Mycobacterium tuberculosis
PDB Compounds: (F:) Arginine repressor ArgR

SCOPe Domain Sequences for d3buef_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3buef_ d.74.2.0 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gtdrmarllgellvstddsgnlavlrtppgaahylasaidraalpqvvgtiagddtilvv
arepttgaqlagmfenlr

SCOPe Domain Coordinates for d3buef_:

Click to download the PDB-style file with coordinates for d3buef_.
(The format of our PDB-style files is described here.)

Timeline for d3buef_: