Lineage for d3btaa3 (3bta A:1-546)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964005Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins)
  6. 2964006Protein Botulinum neurotoxin [55513] (4 species)
  7. 2964007Species Clostridium botulinum, serotype A [TaxId:1491] [55514] (29 PDB entries)
    Uniprot P10845 1-419
  8. 2964044Domain d3btaa3: 3bta A:1-546 [40304]
    Other proteins in same PDB: d3btaa1, d3btaa2, d3btaa4
    complexed with zn

Details for d3btaa3

PDB Entry: 3bta (more details), 3.2 Å

PDB Description: crystal structure of botulinum neurotoxin serotype a
PDB Compounds: (A:) protein (botulinum neurotoxin type a)

SCOPe Domain Sequences for d3btaa3:

Sequence, based on SEQRES records: (download)

>d3btaa3 d.92.1.7 (A:1-546) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
pfvnkqfnykdpvngvdiayikipnvgqmqpvkafkihnkiwviperdtftnpeegdlnp
ppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggs
tidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngyg
stqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiainpnr
vfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkak
sivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvl
nrktylnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknftg
lfefykllcvrgiitsktksldkgynkalndlcikvnnwdlffspsednftndlnkgeei
tsdtnieaaeenisldliqqyyltfnfdnepenisienlssdiigqlelmpnierfpngk
kyeldk

Sequence, based on observed residues (ATOM records): (download)

>d3btaa3 d.92.1.7 (A:1-546) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
pfvnkqfnykdpvngvdiayikipnvgqmqpvkafkihnkiwviperdtftnpeegdlnp
ppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggs
tidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngyg
stqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiainpnr
vfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkak
sivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvl
nrktylnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknftg
lfefykllcvrndlcikvnnwdlffspsednftndlnkgeeitsdtnieaaeenisldli
qqyyltfnfdnepenisienlssdiigqlelmpnierfpngkkyeldk

SCOPe Domain Coordinates for d3btaa3:

Click to download the PDB-style file with coordinates for d3btaa3.
(The format of our PDB-style files is described here.)

Timeline for d3btaa3: