Lineage for d3btaa2 (3bta A:1092-1295)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792430Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2792493Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
    overall fold is very similar to that of the STI family
    automatically mapped to Pfam PF07951
  6. 2792494Protein Botulinum neurotoxin [50402] (2 species)
  7. 2792495Species Clostridium botulinum, serotype A [TaxId:1491] [50403] (10 PDB entries)
  8. 2792511Domain d3btaa2: 3bta A:1092-1295 [25613]
    Other proteins in same PDB: d3btaa1, d3btaa3, d3btaa4
    complexed with zn

Details for d3btaa2

PDB Entry: 3bta (more details), 3.2 Å

PDB Description: crystal structure of botulinum neurotoxin serotype a
PDB Compounds: (A:) protein (botulinum neurotoxin type a)

SCOPe Domain Sequences for d3btaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3btaa2 b.42.4.2 (A:1092-1295) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
nsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylns
slyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleip
dvgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnniaklvasnwynrqie
rssrtlgcswefipvddgwgerpl

SCOPe Domain Coordinates for d3btaa2:

Click to download the PDB-style file with coordinates for d3btaa2.
(The format of our PDB-style files is described here.)

Timeline for d3btaa2: