![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.4: STI-like [50386] (3 families) ![]() |
![]() | Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins) overall fold is very similar to that of the STI family automatically mapped to Pfam PF07951 |
![]() | Protein Botulinum neurotoxin [50402] (2 species) |
![]() | Species Clostridium botulinum, serotype A [TaxId:1491] [50403] (10 PDB entries) |
![]() | Domain d3btaa2: 3bta A:1092-1295 [25613] Other proteins in same PDB: d3btaa1, d3btaa3, d3btaa4 complexed with zn |
PDB Entry: 3bta (more details), 3.2 Å
SCOPe Domain Sequences for d3btaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3btaa2 b.42.4.2 (A:1092-1295) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]} nsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylns slyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleip dvgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnniaklvasnwynrqie rssrtlgcswefipvddgwgerpl
Timeline for d3btaa2: