Lineage for d3bsug_ (3bsu G:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. Superfamily d.100.1: L9 N-domain-like [55658] (3 families) (S)
  5. Family d.100.1.0: automated matches [191537] (1 protein)
    not a true family
  6. Protein automated matches [190913] (1 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188388] (1 PDB entry)
  8. Domain d3bsug_: 3bsu G: [172820]
    Other proteins in same PDB: d3bsua2, d3bsub2, d3bsuf2, d3bsuh2
    automated match to d1qhka_
    protein/DNA complex; protein/RNA complex; complexed with mg

Details for d3bsug_

PDB Entry: 3bsu (more details), 2.1 Å

PDB Description: Hybrid-binding domain of human RNase H1 in complex with 12-mer RNA/DNA
PDB Compounds: (G:) Ribonuclease H1

SCOPe Domain Sequences for d3bsug_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bsug_ d.100.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmfyavrrgrktgvfltwnecraqvdrfpaarfkkfatedeawafvrk

SCOPe Domain Coordinates for d3bsug_ are not available.

Timeline for d3bsug_:

Domains from other chains:
(mouse over for more information)
d3bsua1, d3bsua2, d3bsub1, d3bsub2, d3bsuc_, d3bsuf1, d3bsuf2, d3bsuh1, d3bsuh2