Lineage for d3bs8a_ (3bs8 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1379866Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1379867Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1380518Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 1380809Protein automated matches [190152] (14 species)
    not a true protein
  7. 1380815Species Bacillus subtilis [TaxId:1423] [188688] (1 PDB entry)
  8. 1380816Domain d3bs8a_: 3bs8 A: [172804]
    automated match to d2gsaa_
    complexed with pmp

Details for d3bs8a_

PDB Entry: 3bs8 (more details), 2.3 Å

PDB Description: Crystal structure of Glutamate 1-Semialdehyde Aminotransferase complexed with pyridoxamine-5'-phosphate From Bacillus subtilis
PDB Compounds: (A:) Glutamate-1-semialdehyde 2,1-aminomutase

SCOPe Domain Sequences for d3bs8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bs8a_ c.67.1.4 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mrsyeksktafkeaqklmpggvnspvrafksvdmdpifmergkgskifdidgneyidyvl
swgplilghtndrvveslkkvaeygtsfgaptevenelaklvidrvpsveivrmvssgte
atmsalrlargytgrnkilkfegcyhghgdsllikagsgvatlglpdspgvpegiaknti
tvpyndlesvklafqqfgediagvivepvagnmgvvppqegflqglrditeqygsllifd
evmtgfrvdyncaqgyfgvtpdltclgkviggglpvgayggkaeimeqiapsgpiyqagt
lsgnplamtagletlkqltpdsyknfikkgdrleegiskaaeahgiphtfnragsmigff
ftnepvinyetakasdlklfasyykgmanegvflppsqfeglflstahtdedientiqaa
ekvfaeisrr

SCOPe Domain Coordinates for d3bs8a_:

Click to download the PDB-style file with coordinates for d3bs8a_.
(The format of our PDB-style files is described here.)

Timeline for d3bs8a_: