Lineage for d3broa1 (3bro A:3-137)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 906657Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 906735Protein Transcriptional regulator OEOE1854 [158276] (1 species)
  7. 906736Species Oenococcus oeni [TaxId:1247] [158277] (1 PDB entry)
    Uniprot Q04CY6 3-137
  8. 906737Domain d3broa1: 3bro A:3-137 [155517]
    complexed with cl, gol

Details for d3broa1

PDB Entry: 3bro (more details), 2.04 Å

PDB Description: Crystal structure of the transcription regulator MarR from Oenococcus oeni PSU-1
PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d3broa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]}
rdlgrllkiasnqmstrfdifakkydltgtqmtiidylsrnknkevlqrdlesefsikss
tatvllqrmeikkllyrkvsgkdsrqkclkltkkankletiilsymdsdqsqmtsglnke
evvflekilkrmies

SCOPe Domain Coordinates for d3broa1:

Click to download the PDB-style file with coordinates for d3broa1.
(The format of our PDB-style files is described here.)

Timeline for d3broa1: