![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
![]() | Protein Transcriptional regulator OEOE1854 [158276] (1 species) |
![]() | Species Oenococcus oeni [TaxId:1247] [158277] (1 PDB entry) Uniprot Q04CY6 3-137 |
![]() | Domain d3broa1: 3bro A:3-137 [155517] Other proteins in same PDB: d3brob3 complexed with cl, gol |
PDB Entry: 3bro (more details), 2.04 Å
SCOPe Domain Sequences for d3broa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} rdlgrllkiasnqmstrfdifakkydltgtqmtiidylsrnknkevlqrdlesefsikss tatvllqrmeikkllyrkvsgkdsrqkclkltkkankletiilsymdsdqsqmtsglnke evvflekilkrmies
Timeline for d3broa1:
![]() Domains from other chains: (mouse over for more information) d3brob2, d3brob3, d3broc_, d3brod_ |