Lineage for d3brja1 (3brj A:6-172)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2021055Fold a.285: MtlR-like [158667] (1 superfamily)
    multihelical; 8-helical up-and-down bundle
  4. 2021056Superfamily a.285.1: MtlR-like [158668] (1 family) (S)
    automatically mapped to Pfam PF05068
  5. 2021057Family a.285.1.1: MtlR-like [158669] (2 proteins)
    Pfam PF05068; mannitol repressor
  6. 2021058Protein Mannitol operon repressor MtlR [158672] (1 species)
  7. 2021059Species Vibrio parahaemolyticus [TaxId:670] [158673] (1 PDB entry)
    Uniprot Q87SQ4 6-172
  8. 2021060Domain d3brja1: 3brj A:6-172 [155511]
    complexed with edo, gol

Details for d3brja1

PDB Entry: 3brj (more details), 2.75 Å

PDB Description: Crystal structure of mannitol operon repressor (MtlR) from Vibrio parahaemolyticus RIMD 2210633
PDB Compounds: (A:) Mannitol operon repressor

SCOPe Domain Sequences for d3brja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3brja1 a.285.1.1 (A:6-172) Mannitol operon repressor MtlR {Vibrio parahaemolyticus [TaxId: 670]}
neseiierlnsapsvrgffiatvdvfnesidgliqrifrkdnfavqsvvgpllqdsgplg
dlsvrlkllfglgvlpddiyhdiediiklknhlnsdasdyeftdpnilepikklhlvkkm
gmvqlevnepdddidlefyqlqlqrqqqiiksglslaiveicnelgk

SCOPe Domain Coordinates for d3brja1:

Click to download the PDB-style file with coordinates for d3brja1.
(The format of our PDB-style files is described here.)

Timeline for d3brja1: