Lineage for d3brda3 (3brd A:381-541)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792883Superfamily b.42.7: DNA-binding protein LAG-1 (CSL) [110217] (2 families) (S)
    contains rudiment hairpin triplet lacking one hairpin
    automatically mapped to Pfam PF09270
  5. 2792884Family b.42.7.1: DNA-binding protein LAG-1 (CSL) [110218] (1 protein)
  6. 2792885Protein DNA-binding protein LAG-1 (CSL) [110219] (1 species)
  7. 2792886Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110220] (4 PDB entries)
    Uniprot Q9TYY1 195-660
  8. 2792888Domain d3brda3: 3brd A:381-541 [155507]
    Other proteins in same PDB: d3brda1, d3brda2
    automated match to d1ttua3
    protein/DNA complex; complexed with edo

Details for d3brda3

PDB Entry: 3brd (more details), 2.21 Å

PDB Description: csl (lag-1) bound to dna with lin-12 ram peptide, p212121
PDB Compounds: (A:) Lin-12 and glp-1 phenotype protein 1, isoform a

SCOPe Domain Sequences for d3brda3:

Sequence, based on SEQRES records: (download)

>d3brda3 b.42.7.1 (A:381-541) DNA-binding protein LAG-1 (CSL) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaftihlfdderglqetd
nfavrdgfvyygsvvklvdsvtgialprlrirkvdkqqvildascseepvsqlhkcafqm
idnelvylclshdkiiqhqatainehrhqindgaawtiist

Sequence, based on observed residues (ATOM records): (download)

>d3brda3 b.42.7.1 (A:381-541) DNA-binding protein LAG-1 (CSL) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaftihlfddqetdnfav
rdgfvyygsvvklvdsvtgialprlrirkvdkqqvildascseepvsqlhkcafqmidne
lvylclshdkiiqhqatainehrhqindgaawtiist

SCOPe Domain Coordinates for d3brda3:

Click to download the PDB-style file with coordinates for d3brda3.
(The format of our PDB-style files is described here.)

Timeline for d3brda3: