Lineage for d3bqqa_ (3bqq A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716976Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 2716977Superfamily a.64.1: Saposin [47862] (5 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 2716978Family a.64.1.1: NKL-like [47863] (4 proteins)
  6. 2716985Protein Saposin C [89077] (1 species)
  7. 2716986Species Human (Homo sapiens) [TaxId:9606] [89078] (11 PDB entries)
  8. 2716987Domain d3bqqa_: 3bqq A: [172790]
    automated match to d2gtga1

Details for d3bqqa_

PDB Entry: 3bqq (more details), 2 Å

PDB Description: Crystal Structure of Human Saposin D (triclinic)
PDB Compounds: (A:) Proactivator polypeptide

SCOPe Domain Sequences for d3bqqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bqqa_ a.64.1.1 (A:) Saposin C {Human (Homo sapiens) [TaxId: 9606]}
dggfcevckklvgyldrnleknstkqeilaalekgcsflpdpyqkqcdqfvaeyepvlie
ilvevmdpsfvclkigacps

SCOPe Domain Coordinates for d3bqqa_:

Click to download the PDB-style file with coordinates for d3bqqa_.
(The format of our PDB-style files is described here.)

Timeline for d3bqqa_: