Lineage for d3boya_ (3boy A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009431Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
    alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234
  4. 3009432Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family) (S)
    automatically mapped to Pfam PF09021
  5. 3009433Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (2 proteins)
  6. 3009434Protein Hut operon positive regulatory protein HutP [111066] (1 species)
    an RNA-binding antitermination protein
  7. 3009435Species Bacillus subtilis [TaxId:1423] [111067] (5 PDB entries)
    Uniprot P10943
  8. 3009439Domain d3boya_: 3boy A: [155459]
    automated match to d1veab_
    protein/RNA complex; complexed with his, mg

Details for d3boya_

PDB Entry: 3boy (more details), 1.7 Å

PDB Description: crystal structure of the hutp antitermination complex bound to the hut mrna
PDB Compounds: (A:) Hut operon positive regulatory protein

SCOPe Domain Sequences for d3boya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3boya_ d.275.1.1 (A:) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]}
tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
avslygtigapikglehetfgvginhi

SCOPe Domain Coordinates for d3boya_:

Click to download the PDB-style file with coordinates for d3boya_.
(The format of our PDB-style files is described here.)

Timeline for d3boya_: