Lineage for d3bnba2 (3bnb A:6-149)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
sandwich; 8 strands in 2 sheets; complex topology
duplication: has weak internal pseudo twofold symmetrySuperfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) 
Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins) Protein Plant lipoxigenase [49725] (2 species) Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (22 PDB entries) 
Domain d3bnba2: 3bnb A:6-149 [155431]
Other proteins in same PDB: d3bnba1
automated match to d1ygea2
complexed with fe; mutant
Details for d3bnba2
PDB Entry: 3bnb (more details), 1.45 Å
PDB Description: lipoxygenase-1 (soybean) i553l mutant
PDB Compounds: (A:) seed lipoxygenase-1SCOPe Domain Sequences for d3bnba2:
Sequence, based on SEQRES records: (download)
>d3bnba2 b.12.1.1 (A:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
hkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgkdtfle
gintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirf
vcnswvyntklyksvriffanhty
Sequence, based on observed residues (ATOM records): (download)
>d3bnba2 b.12.1.1 (A:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
hkikgtvvlmpknnlnaflgrsvslqlisatkadahgkgkvgkdtflegintslptlgag
esafnihfewdgsmgipgafyiknymqvefflksltleagtirfvcnswvyntklyksvr
iffanhty
SCOPe Domain Coordinates for d3bnba2:
Click to download the PDB-style file with coordinates for d3bnba2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3bnba2:
- d3bnba2 first appeared in SCOP 1.75
- d3bnba2 appears in SCOPe 2.06
- d3bnba2 appears in the current release, SCOPe 2.08
View in 3D
