Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Cyclodextrin glycosyltransferase [51018] (5 species) contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like |
Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [51023] (4 PDB entries) |
Domain d3bmva3: 3bmv A:407-495 [155418] Other proteins in same PDB: d3bmva1, d3bmva2, d3bmva4 automated match to d3bmva3 complexed with ca, gol, so4; mutant |
PDB Entry: 3bmv (more details), 1.6 Å
SCOPe Domain Sequences for d3bmva3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bmva3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]} gttqqrwinndvyiyerkfgnnvalvainrnlstsynitglytalpagtytdvlggllng nsisvasdgsvtpftlsagevavwqyvss
Timeline for d3bmva3: