Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.14: Sbal0622-like [159985] (1 protein) PfamB PB002762 automatically mapped to Pfam PF12893 |
Protein Uncharacterized protein Sbal0622 [159986] (1 species) |
Species Shewanella baltica [TaxId:62322] [159987] (1 PDB entry) Uniprot A3D088 3-126 |
Domain d3blza1: 3blz A:3-126 [155403] complexed with edo, peg |
PDB Entry: 3blz (more details), 1.75 Å
SCOPe Domain Sequences for d3blza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3blza1 d.17.4.14 (A:3-126) Uncharacterized protein Sbal0622 {Shewanella baltica [TaxId: 62322]} nttyvqeyhaivevlskyneggkkadstimrpafssqatifgvdvdnkltggpiqglfdv idnvfhpspeakaaiaridivgtaasaridtddisgfrftdffnllkvegkwtvvskiyh thps
Timeline for d3blza1: