Lineage for d3blhb1 (3blh B:151-259)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.74: Cyclin-like [47953] (1 superfamily)
core: 5 helices; one helix is surrounded by the othersSuperfamily a.74.1: Cyclin-like [47954] (4 families) 
duplication: consists of two domains of this foldFamily a.74.1.1: Cyclin [47955] (9 proteins) 
Protein Cyclin T1 [158595] (1 species) Species Human (Homo sapiens) [TaxId:9606] [158596] (10 PDB entries)
Uniprot O60563 151-259! Uniprot O60563 151-263! Uniprot O60563 5-150! Uniprot O60563 8-150
Domain d3blhb1: 3blh B:151-259 [155394]
Other proteins in same PDB: d3blha1
complexed with trs
Details for d3blhb1
PDB Entry: 3blh (more details), 2.48 Å
PDB Description: crystal structure of human cdk9/cyclint1
PDB Compounds: (B:) Cyclin-T1SCOPe Domain Sequences for d3blhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3blhb1 a.74.1.1 (B:151-259) Cyclin T1 {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldelthellqilektpnrlkriwnwr
SCOPe Domain Coordinates for d3blhb1:
Click to download the PDB-style file with coordinates for d3blhb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3blhb1:
- d3blhb1 first appeared in SCOP 1.75
- d3blhb1 appears in SCOPe 2.05
- d3blhb1 appears in SCOPe 2.07
- d3blhb1 appears in the current release, SCOPe 2.08
View in 3D
