Lineage for d3blhb1 (3blh B:151-259)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003386Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2003387Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2003388Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2003770Protein Cyclin T1 [158595] (1 species)
  7. 2003771Species Human (Homo sapiens) [TaxId:9606] [158596] (10 PDB entries)
    Uniprot O60563 151-259! Uniprot O60563 151-263! Uniprot O60563 5-150! Uniprot O60563 8-150
  8. 2003772Domain d3blhb1: 3blh B:151-259 [155394]
    Other proteins in same PDB: d3blha1
    complexed with trs

Details for d3blhb1

PDB Entry: 3blh (more details), 2.48 Å

PDB Description: crystal structure of human cdk9/cyclint1
PDB Compounds: (B:) Cyclin-T1

SCOPe Domain Sequences for d3blhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3blhb1 a.74.1.1 (B:151-259) Cyclin T1 {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldelthellqilektpnrlkriwnwr

SCOPe Domain Coordinates for d3blhb1:

Click to download the PDB-style file with coordinates for d3blhb1.
(The format of our PDB-style files is described here.)

Timeline for d3blhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3blhb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3blha1