![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Cell division protein kinase 9, CDK9 [160810] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [160811] (1 PDB entry) Uniprot P50750 8-325 |
![]() | Domain d3blha1: 3blh A:8-325 [155393] Other proteins in same PDB: d3blhb1, d3blhb2 complexed with trs |
PDB Entry: 3blh (more details), 2.48 Å
SCOPe Domain Sequences for d3blha1:
Sequence, based on SEQRES records: (download)
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei kilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlvkftlseik rvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytn rvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgs itpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsd dalnhdffwsdpmpsdlk
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvekegfpitalreikilq llkhenvvnlieicrtsiylvfdfcehdlagllsnvlvkftlseikrvmqmllnglyyih rnkilhrdmkaanvlitrdgvlkladfglarafslpnrytnrvvtlwyrppelllgerdy gppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpnvdnylvkgqkr kvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdffwsdpmpsdlk
Timeline for d3blha1: